PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn225931
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family BES1
Protein Properties Length: 363aa    MW: 41024.6 Da    PI: 7.609
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn225931genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82260.66.8e-1946873576
      DUF822 35 aqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76
                   n+klpk+ DnneVlkALc+e Gwvve+DGt yrk   + 
  Achn225931 46 PTMNFKLPKHGDNNEVLKALCTEVGWVVENDGTAYRKRVLQG 87
                567*********************************876444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056877.3E-174886IPR008540BES1/BZR1 plant transcription factor, N-terminal
SMARTSM003202.8E-787127IPR001680WD40 repeat
SuperFamilySSF509781.26E-4090309IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.102.9E-4091310IPR015943WD40/YVTN repeat-like-containing domain
PfamPF004001.5E-593127IPR001680WD40 repeat
PROSITE profilePS5029416.00694260IPR017986WD40-repeat-containing domain
PROSITE profilePS5008213.5594136IPR001680WD40 repeat
PROSITE patternPS006780114128IPR019775WD40 repeat, conserved site
PfamPF128941.0E-4145191IPR024977Anaphase-promoting complex subunit 4, WD40 domain
SMARTSM00320180171209IPR001680WD40 repeat
SMARTSM003202.3E-8212251IPR001680WD40 repeat
PfamPF004005.1E-4215251IPR001680WD40 repeat
PROSITE profilePS5008212.58219260IPR001680WD40 repeat
SMARTSM003209.4277315IPR001680WD40 repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010267Biological Processproduction of ta-siRNAs involved in RNA interference
GO:0000347Cellular ComponentTHO complex
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MKTENTVNLA RSLDTCLRIG ITEKKRGKDL DYLSCSTRVE EAERRPTMNF KLPKHGDNNE  60
VLKALCTEVG WVVENDGTAY RKRVLQGKVK DIELKGHTDS VDQLCWDPKH AYLIATASGD  120
KTVCLWDARS EKCSQQAELS GENINITYKP DGTHIAVGNR DDELTILDVR KFKAIHKWKF  180
NYEVNEIAWN MRGDMFFLTT GNGTVEVLAY PSLQAVSTLT AHTAGCYCIA IDPLGRYFAV  240
GSADSLVSLW DISEMLCVRT FTKLDNYCIL KQSNVQTGRS VHQIPVRAAI NSVEWNPKYN  300
LLAYAGDDKN KYQADEVTVV SSFQQSCVDS PEMAEYLCRF QSPELRRWRA WPLVRRSGGR  360
ER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1vyh_C7e-1294267146340PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_D7e-1294267146340PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_G7e-1294267146340PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_H7e-1294267146340PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_K7e-1294267146340PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_L7e-1294267146340PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_O7e-1294267146340PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_P7e-1294267146340PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_S7e-1294267146340PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_T7e-1294267146340PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097701.11e-146PREDICTED: THO complex subunit 3
SwissprotQ9FKT51e-136THOC3_ARATH; THO complex subunit 3
TrEMBLA0A059BRQ31e-145A0A059BRQ3_EUCGR; Uncharacterized protein
STRINGGLYMA18G07920.11e-142(Glycine max)
STRINGSolyc07g066060.2.11e-142(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36780.13e-13BES1/BZR1 homolog 2